Invitrogen™ Human PPP2R3B (aa 388-536) Control Fragment Recombinant Protein

Product Code. 30213308

Brand: Invitrogen™ RP108760

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase 2 is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9Y5P8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28227
• Name: Human PPP2R3B (aa 388-536) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: NYREN8; NY-REN-8; NY-REN-8 antigen; PP2A subunit B isoform PR48; PP2A, subunit B, PR48 isoform; PPP2R3B; PPP2R3L; PPP2R3LY; PR48; protein phosphatase 2 (formerly 2 A), regulatory subunit B'', beta; protein phosphatase 2 regulatory subunit B'', beta; protein phosphatase 2 regulatory subunit B''beta; protein phosphatase 2, regulatory subunit B'', beta; Protein phosphatase 2 A 48 kDa regulatory subunit; serine/threonine protein phosphatase 2 A, 48 kDa regulatory subunit B; serine/threonine-protein phosphatase 2 A regulatory subunit B'' subunit beta
• Common Name: PPP2R3B
• Gene Symbol: PPP2R3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining