missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPP2R3A (aa 24-122) Control Fragment Recombinant Protein

Product Code. 30194127
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194127

Brand: Invitrogen™ RP96285

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57416 (PA5-57416. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B'/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holoenzyme. The product of this gene belongs to the B' family. The B' family has been further divided into subfamilies. The product of this gene belongs to the alpha subfamily of regulatory subunit B'. Alternative splicing results in multiple transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06190
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5523
Name Human PPP2R3A (aa 24-122) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3222402P14Rik; A730042E07; DNA for thyroid hormone receptor binding site (258 bp); PP2A subunit B isoform PR72/PR130; PP2A subunit B isoform R3 isoform; PP2A subunit B isoforms B72/B130; PP2A subunit B isoforms B''-PR72/PR130; PP2A, subunit B, R3 isoform; PPP2R3; PPP2R3A; PR130; PR72; protein phosphatase 2 (formerly 2 A), regulatory subunit B'' (PR 72), alpha isoform and (PR 130), beta isoform; protein phosphatase 2 (formerly 2 A), regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B'', alpha; protein phosphatase 2 regulatory subunit B''alpha; protein phosphatase 2, regulatory subunit B'', alpha; serine/threonine-protein phosphatase 2 A 72/130 kDa regulatory subunit B; Serine/threonine-protein phosphatase 2 A regulatory subunit B'' subunit alpha; Serine/threonine-protein phosphatase 2 A regulatory subunit B'' subunit alpha-like protein
Common Name PPP2R3A
Gene Symbol PPP2R3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPVSQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFASG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.