Invitrogen™ Human PPP2R1B (aa 566-667) Control Fragment Recombinant Protein

Product Code. 30203374

Brand: Invitrogen™ RP92510

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53877 (PA5-53877. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In eukaryotes, the phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions, including division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the protein phosphatases. In general, the protein phosphatase (PP) holoenzyme is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. Four major families of protein phosphatase catalytic subunits have been identified, designated PP1, PP2A, PP2B (calcineurin) and PP2C. An additional protein phosphatase catalytic subunit, PPX (also known as PP4), is a putative member of a novel PP family. The PP2A family comprises subfamily members PP2A alpha and PP2A beta. The PP2A catalytic subunit associates with a variety of regulatory subunits. Regulatory subunits include PP2A-A alpha and -A beta, PP2A-B alpha and -B beta, PP2A-C alpha and -C beta, and PP2A-B56 alpha and -B56 beta.

Specifications

• Accession Number: P30154
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5519
• Name: Human PPP2R1B (aa 566-667) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410091N08Rik; AI790395; PP2A A beta; PP2A -AR1 beta; PP2A subunit A isoform PR65-beta; PP2A subunit A isoform R1-beta; PP2A, subunit A, PR65-beta isoform; PP2A, subunit A, R1-beta isoform; PP2AA beta; PP2A-A beta; PP2A-Abeta; PP2A-APR65 beta; PPP2R1B; PR65B; protein phosphatase 2 (formerly 2 A), regulatory subunit A (PR 65), beta isoform; protein phosphatase 2 (formerly 2 A), regulatory subunit A, beta isoform; protein phosphatase 2 regulatory subunit A, beta; protein phosphatase 2 scaffold subunit Abeta; protein phosphatase 2, regulatory subunit A, beta; protein phosphatase 2, structural/regulatory subunit A, beta; serine/threonine-protein phosphatase 2 A 65 kDa regulatory subunit A beta isoform
• Common Name: PPP2R1B
• Gene Symbol: Ppp2r1b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NALQGEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining