Invitrogen™ Human PPP1R9A (aa 44-125) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30211301	100 μL	100µL

Product Code. 30211301 Supplier Invitrogen™ Supplier No. RP108657

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111734 (PA5-111734. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Neurabin I is a brain-specific protein which contains an F-actin binding domain, a PDZ domain, a transmembrane-protein-interacting-domain, and a coiled-coil region. As its structure suggests, neurabin I is a promiscuous protein binding to F-actin, protein phosphatase 1, TGN38, and p70 S6 kinase. Found exclusively in brain, this protein is highly concentrated in the synapse and has also been shown to be enriched in the lamellipodia of the growth cone during neuronal development. Neurabin I appears to be a bridging protein by targeting other proteins to the synapse or by linking membrane proteins to the actin cytoskeleton.

Specifications

• Accession Number: Q9ULJ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55607
• Name: Human PPP1R9A (aa 44-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810430P21Rik; 4930518N04Rik; 5330407E15; A230094E16Rik; actin-binding protein neurabin; BB181831; KIAA1222; mKIAA1222; Neb1; neurabin 1; Neurabin I; neurabin-1; Neurabin-I; neural tissue-specific F-actin binding protein; neural tissue-specific F-actin-binding protein I; NRB; NRB1; NRBI; p180; PP1bp175; Ppp1r9a; Protein phosphatase 1 regulatory subunit 9 A; protein phosphatase 1, regulatory (inhibitor) subunit 9 A; protein phosphatase 1, regulatory subunit 9 A
• Common Name: PPP1R9A
• Gene Symbol: PPP1R9A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining