Invitrogen™ Human PPP1R8 (aa 177-264) Control Fragment Recombinant Protein

Product Code. 30212120

Brand: Invitrogen™ RP94133

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55601 (PA5-55601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Specifications

• Accession Number: Q12972
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5511
• Name: Human PPP1R8 (aa 177-264) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330548N22Rik; activator of RNA decay; ARD1; ARD-1; AU044684; LOC100722083; NIPP1; NIPP-1; NIPP-1, nuclear inhibitor of protein phosphatase-1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; nuclear inhibitor of protein phosphatase-1 beta; nuclear subunit of PP-1; Ppp1r8; PRO2047; protein phosphatase 1 regulatory inhibitor subunit 8; protein phosphatase 1 regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; protein phosphatase 1, regulatory inhibitor subunit 8; protein phosphatase 1, regulatory subunit 8; RNase E
• Common Name: PPP1R8
• Gene Symbol: PPP1R8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining