Invitrogen™ Human PPP1R7 (aa 61-138) Control Fragment Recombinant Protein

Product Code. 30212544

Brand: Invitrogen™ RP96028

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56957 (PA5-56957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In eukaryotes, the phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions, including division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the protein phosphatases. In general, the protein phosphatase 1 (PP1) holoenzyme is a trimeric complex composed of a regulatory subunit, a variable subunit, and a catalytic subunit. Sds22, also known as PPP1R7 (protein phosphatase 1, regulatory (inhibitor) subunit 7), is a 360 amino acid protein that localizes to the nucleus and contains ten LRR (leucine rich) repeats. Expressed in a variety of tissues, Sds22 functions as a regulatory subunit of the PP1 complex, suggesting a role in protein regulation throughout the cell. Multiple isoforms of Sds22 exist due to alternative splicing events.

Specifications

• Accession Number: Q15435
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5510
• Name: Human PPP1R7 (aa 61-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310014J01Rik; hypothetical protein LOC560323; im:7136431; Ppp1r7; Protein phosphatase 1 regulatory subunit 22; protein phosphatase 1 regulatory subunit 7; protein phosphatase 1, regulatory (inhibitor) subunit 7; protein phosphatase 1, regulatory subunit 7; protein phosphatase-1 regulatory subunit 7; Sds22; testis secretory sperm-binding protein Li 210 A; zgc:123325
• Common Name: PPP1R7
• Gene Symbol: PPP1R7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining