Invitrogen™ Human PPP1R42 (aa 1-73) Control Fragment Recombinant Protein

Product Code. 30209855

Brand: Invitrogen™ RP93968

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55924 (PA5-55924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates phosphatase activity of protein phosphatase 1 (PP1) complexes in the testis.

Specifications

• Accession Number: Q7Z4L9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 286187
• Name: Human PPP1R42 (aa 1-73) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700011J18Rik; 4930418G15Rik; dtr; leucine rich repeat containing 67; leucine-rich repeat-containing protein 67; Lrrc67; PPP1R42; Protein phosphatase 1 regulatory subunit 42; protein phosphatase 1, regulatory subunit 42; testis leucine-rich repeat; testis leucine-rich repeat protein; TLLR; TLRR
• Common Name: PPP1R42
• Gene Symbol: PPP1R42
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MVRLTLDLIARNSNLKPRKEETISQCLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDNCISQITNLNYATN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining