Invitrogen™ Human PPP1R3D (aa 112-187) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30181421	100 μL	100µL

Product Code. 30181421 Supplier Invitrogen™ Supplier No. RP99431

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59450 (PA5-59450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Seems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis.

Specifications

• Accession Number: O95685
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5509
• Name: Human PPP1R3D (aa 112-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610024M03Rik; Gm359; PP1 subunit R6; PPP1R3D; PPP1R6; protein phosphatase 1 regulatory subunit 3 D; Protein phosphatase 1 regulatory subunit 6; protein phosphatase 1, regulatory (inhibitor) subunit 3 D; protein phosphatase 1, regulatory subunit 3 D; protein phosphatase 1, regulatory subunit 6, spinophilin; protein phosphatase 1-binding subunit R6
• Common Name: PPP1R3D
• Gene Symbol: PPP1R3D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining