Invitrogen™ Human PPP1R3C (aa 12-119) Control Fragment Recombinant Protein

Product Code. 30199869

Brand: Invitrogen™ RP91067

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55493 (PA5-55493. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase-1 (PP1; see MIM 176875) participates in the regulation of a wide variety of cellular functions by reversible protein phosphorylation. The ability of PP1 to regulate diverse functions resides in its capacity to interact with a variety of regulatory subunits that may target PP1 to specific subcellular locations, modulate its substrate specificity, and allow its activity to be responsive to extracellular signals. Several targeting subunits of PP1 have been identified, including PPP1R5, the glycogen-binding subunits PPP1R3 (MIM 600917) and PPP1R4, and the nuclear inhibitor of PP1 (PPP1R8; MIM 602636).

Specifications

• Accession Number: Q9UQK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5507
• Name: Human PPP1R3C (aa 12-119) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Phosphatase 1, regulatory inhibitor subunit 5; PP1 subunit R5; PPP1R3C; PPP1R5; protein phosphatase 1 binding protein PTG; protein phosphatase 1 regulatory subunit 3 C; Protein phosphatase 1 regulatory subunit 5; protein phosphatase 1, regulatory (inhibitor) subunit 3 C; protein phosphatase 1, regulatory (inhibitor) subunit 5; protein phosphatase 1, regulatory subunit 3 C; protein targeting to glicogen; protein targeting to glycogen; PTG
• Common Name: PPP1R3C
• Gene Symbol: PPP1R3C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining