Invitrogen™ Human PPP1R14D (aa 17-120) Control Fragment Recombinant Protein

Product Code. 30182215

Brand: Invitrogen™ RP98120

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59752 (PA5-59752. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase-1 (PP1; see MIM 176875) is a major cellular phosphatase that reverses serine/threonine protein phosphorylation. PPP1R14D is a PP1 inhibitor that itself is regulated by phosphorylation (Liu et al., 2004 ).

Specifications

• Accession Number: Q9NXH3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54866
• Name: Human PPP1R14D (aa 17-120) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2010107K19Rik; CPI17-like; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI; GBPI1; GBPI-1; gut and brain phosphatase inhibitor 1; PKC-dependent PP1 inhibitory protein; PKC-dependent PP1 inhibitory protein subunit 14; Ppp1r14; PPP1R14D; protein phosphatase 1 regulatory inhibitor subunit 14 D; protein phosphatase 1 regulatory subunit 14 D; protein phosphatase 1, regulatory (inhibitor) subunit 14 D
• Common Name: PPP1R14D
• Gene Symbol: PPP1R14D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining