Invitrogen™ Human PPP1R10 (aa 364-462) Control Fragment Recombinant Protein

Product Code. 30195610

Brand: Invitrogen™ RP103267

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63345 (PA5-63345. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA polymerases transcribe nuclear genes for ribosomal RNA, thus representing ribosomal biogenesis. RNA polymerase I (Pol I) is located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription machinery are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I transcription. RPA40 and RPA16 are subunits of Pol I that associate with each other at an early stage of RNA polymerase I assembly. RPA40 is essential for the function and integrity of the complex and is also an essential subunit of RNA polymerase III (Pol III). RPA40, RPA16 and RPA135 encode the three subunits of RNA polymerase I, respectively. RPA194 is the largest subunit of RNA Pol I and is not a component of Pol II and Pol III.

Specifications

• Accession Number: Q96QC0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5514
• Name: Human PPP1R10 (aa 364-462) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610025H06Rik; Cat53; D17Ertd808e; Fb19; HLA-C adjacent transcript 53; HLA-C associated transcript 53; MHC class I region proline-rich protein CAT53; p99; Phosphatase 1 nuclear targeting subunit; Pnuts; PNUTSPP1R10; PP1-binding protein of 114 kDa; PP1R10; PPP1R10; Protein FB19; protein phosphatase 1 regulatory subunit 10; protein phosphatase 1, regulatory (inhibitor) subunit 10; protein phosphatase 1, regulatory subunit 10; protein phosphatase I; Protein PNUTS; putative protein phosphatase 1 nuclear targeting subunit; R111; Serine/threonine-protein phosphatase 1 regulatory subunit 10; testis tissue sperm-binding protein Li 67 n
• Common Name: PPP1R10
• Gene Symbol: PPP1R10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETERVNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining