Invitrogen™ Human PPME1 (aa 17-86) Control Fragment Recombinant Protein

Product Code. 30205414

Brand: Invitrogen™ RP102950

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60545 (PA5-60545. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.

Specifications

• Accession Number: Q9Y570
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51400
• Name: Human PPME1 (aa 17-86) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110069N17Rik; 2700017M01Rik; Pme1; PME-1; PP2593; PPME1; PRO0750; Protein phosphatase methylesterase 1; protein phosphatase methylesterase-1; RGD1309683; testicular secretory protein Li 39
• Common Name: PPME1
• Gene Symbol: Ppme1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining