missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206747

Invitrogen™ Human PPIL2 (aa 191-265) Control Fragment Recombinant Protein

Product Code. 30206747
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206747 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206747 Supplier Invitrogen™ Supplier No. RP105017

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111423 (PA5-111423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. Multiple transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13356
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23759
Name Human PPIL2 (aa 191-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610009L05Rik; 1700016N17Rik; 4921520K19Rik; 4930511F14Rik; AA589416; C130078A06Rik; CYC4; cyclophilin, 60 kDa; cyclophilin-60; Cyclophilin-like protein Cyp-60; CYP60; Cyp-60; hCyP-60; peptidylprolyl cis-trans isomerase; peptidyl-prolyl cis-trans isomerase-like 2; peptidylprolyl isomerase (cyclophilin)-like 2; peptidylprolyl isomerase like 2; peptidylprolyl isomerase-like 2; PPIase; PPIL2; Probable inactive peptidyl-prolyl cis-trans isomerase-like 2; RING-type E3 ubiquitin-protein ligase PPIL2; Rotamase PPIL2; U-box domain containing 7; UBO x 7
Common Name PPIL2
Gene Symbol PPIL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.