Invitrogen™ Human PPIG Control Fragment Recombinant Protein

Product Code. 30201043

Brand: Invitrogen™ RP103943

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84346 (PA5-84346. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Structural Maintenance of Chromosomes (SMC) family proteins play critical roles in various nuclear events that require structural changes of chromosomes, including mitotic chromosome organization, DNA recombination and repair and global transcriptional repression. The chromo proteins are conserved in eukaryotes and lead to mitotic chromosome segregation defects. This suggests a critical function of SMC family proteins in mitotic chromosome dynamics. SMC1 and SMC3 form a heterodimeric complex required for metaphase progression in mitotic cells. Specifically this SMC1/SMC3 complex is responsible for sister chromatid cohesion during metaphase. Mutations in the gene can lead to Cornelia de Lange syndrome 2.

Specifications

• Accession Number: Q13427
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9360
• Name: Human PPIG Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU019516; AU022200; B230312B02Rik; CARS-cyclophilin; CARS-Cyp; CASP10; Clk-associating RS-cyclophilin; Cyclophilin G; CYP; Matrin cyclophilin; matrin cyclophilin (matrin-cyp); matrin-cyp; MGC133241; OTTHUMP00000204761; OTTHUMP00000204762; Peptidyl-prolyl cis-trans isomerase G; peptidylprolyl isomerase G; peptidyl-prolyl isomerase G; peptidylprolyl isomerase G (cyclophilin G); peptidyl-prolyl isomerase G (cyclophilin G); PPIase G; PPIG; Rotamase G; SCAF10; SR-cyclophilin; SRCyp; SR-cyp; SR-related CTD-associated factor 10
• Common Name: PPIG
• Gene Symbol: PPIG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining