Invitrogen™ Human PPFIBP2 (aa 264-382) Control Fragment Recombinant Protein

Product Code. 30196239

Brand: Invitrogen™ RP102102

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52020 (PA5-52020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q8ND30
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8495
• Name: Human PPFIBP2 (aa 264-382) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cclp1; coiled-coil-like protein 1; liprin beta 2; liprin-beta-2; PPFIA binding protein 2; Ppfibp2; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 2; protein tyrosine phosphatase, receptor-type, F interacting protein, binding protein 2; PTPRF interacting protein, binding protein 2 (liprin beta 2); PTPRF-interacting protein-binding protein 2
• Common Name: PPFIBP2
• Gene Symbol: PPFIBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TAALHSESHTERDQEIQRLKMGMETLLLANEDKDRRIEELTGLLNQYRKVKEIVMVTQGPSERTLSINEEEPEGGFSKWNATNKDPEELFKQEMPPRCSSPTVGPPPLPQKSLETRAQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining