Invitrogen™ Human PPFIBP1 (aa 367-490) Control Fragment Recombinant Protein

Product Code. 30198110

Brand: Invitrogen™ RP102023

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51663 (PA5-51663. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Specifications

• Accession Number: Q86W92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8496
• Name: Human PPFIBP1 (aa 367-490) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4632409B19Rik; AW214454; AW261454; hSGT2; hSgt2p; KIAA1230; L2; liprin beta 1; liprin related protein; liprin-beta 1; liprin-beta-1; PPFIA binding protein 1; Ppfibp1; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein-binding protein 1; protein-tyrosine phosphatase receptor-type f polypeptide-interacting protein-binding protein 1; PTPRF interacting protein, binding protein 1 (liprin beta 1); PTPRF-interacting protein-binding protein 1; SGT2
• Common Name: PPFIBP1
• Gene Symbol: PPFIBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining