Invitrogen™ Human PPFIA4 (aa 177-232) Control Fragment Recombinant Protein

Product Code. 30205739

Brand: Invitrogen™ RP100956

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62787 (PA5-62787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PPFIA4, or liprin-alpha-4, belongs to the liprin-alpha gene family. See liprin-alpha-1 (LIP1, or PPFIA1; MIM 611054) for background on liprins.

Specifications

• Accession Number: O75335
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8497
• Name: Human PPFIA4 (aa 177-232) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110008G13Rik; AI448359; AI852265; C81506; KIAA0897; Liprin-alpha4; Liprin-alpha-4; LOW QUALITY PROTEIN: liprin-alpha-4; PPFIA4; Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-4; protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4; PTPRF interacting protein alpha 4; PTPRF-interacting protein alpha-4
• Common Name: PPFIA4
• Gene Symbol: PPFIA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining