missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPAR gamma (aa 249-319) Control Fragment Recombinant Protein

Product Code. 30209559
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209559 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209559 Supplier Invitrogen™ Supplier No. RP106329

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P37231
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5468
Name Human PPAR gamma (aa 249-319) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CIMT1; GLM1; HUMPPARG; NR1C3; nuclear hormone receptor; nuclear hormone receptor; PPARG; Nuclear receptor subfamily 1 group C member 3; nuclear receptor transcription factor; OTTHUMP00000185032; OTTHUMP00000185036; peroxisome proliferative activated receptor, gamma; peroxisome proliferative activated receptor, gamma-2; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor gamma; peroxisome proliferator activated receptor gamma 1; peroxisome proliferator activated receptor gamma 2; peroxisome proliferator activated receptor gamma 4; peroxisome proliferator activated receptor gamma-1; peroxisome proliferator activated receptor gamma-2; peroxisome proliferator activatived receptor gamma; peroxisome proliferator activator receptor, gamma; peroxisome proliferator-activated nuclear receptor gamma variant 1; peroxisome proliferator-activated receptor; peroxisome proliferator-activated receptor gamma; peroxisome proliferator-activated receptor gamma 1; peroxisome proliferator-activated receptor gamma 1 A; peroxisome proliferator-activated receptor gamma 1-a; peroxisome proliferator-activated receptor gamma 1 b; peroxisome proliferator-activated receptor gamma 1-b; peroxisome proliferator-activated receptor gamma 1 c; peroxisome proliferator-activated receptor gamma 1 d; peroxisome proliferator-activated receptor gamma 2; peroxisome proliferator-activated receptor-gamma; peroxisome proliferator-activated receptor-gamma 2; peroxisome proliferator-cctivated receptor gamma 1; PPAR gamma; PPAR gamma 1; PPAR gamma 3; Pparg; PPARG1; PPARG2; PPARgamma; PPAR-gamma; PPARgamma2; PPAR-gamma2; PPARy; proliferator activated gamma; transcription factor
Common Name PPAR gamma
Gene Symbol PPARG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.