missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPAR alpha (aa 242-286) Control Fragment Recombinant Protein

Product Code. 30199107
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199107

Brand: Invitrogen™ RP105413

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells through their interaction with members of the nuclear hormone receptor family termed peroxisome proliferator activated receptors (PPAR's). Nuclear hormone receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate ligand. Studies indicate that PPAR's are activated by peroxisome proliferators such as clofibric acid, nafenopin, and WY-14,643, as well as by some fatty acids. It has also been shown that PPAR's can induce transcription of acyl coenzyme A oxidase & cytochrome P450 (CYP450) A6 through interaction with specific response elements. PPAR, like several other nuclear hormone receptors, heterodimerizes with retinoid X receptor (RXR) alpha.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07869
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5465
Name Human PPAR alpha (aa 242-286) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933429D07Rik; AW742785; hPPAR; I79_022392; MGC2237; MGC2452; Nr1c1; nuclear hormone receptor; nuclear receptor; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor alpha; peroxisome proliferative activated receptor, alpha; peroxisome proliferative activated receptor, alpha isoform 1; peroxisome proliferator; peroxisome proliferator activated receptor; peroxisome proliferator activated receptor alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3; peroxisome proliferator-activated receptor alpha; PPAR; PPAR ALPHA; Ppara; PPARALPHA; PPAR-alpha; proliferator-activated receptor alpha; transcription factor belonging to the nuclear receptor superfamily
Common Name PPAR alpha
Gene Symbol PPARA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt