missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195810

Invitrogen™ Human PPAPDC2 (aa 192-223) Control Fragment Recombinant Protein

Product Code. 30195810
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195810

Brand: Invitrogen™ RP91123

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53722 (PA5-53722. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PPAPDC2 is a phosphatase that dephosphorylates Presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP), suggesting that it may have important role in innate immunity. PSDP is a bioactive lipid that rapidly remodels to PSMP upon cell activation. PPAPDC2 displays diphosphate phosphatase activity with a substrate preference for PSDP - FDP - phosphatidic acid. PPAPDC2 activity is independent of Mg2+ and has been identified in activated human neutrophil (PMN) extracts. It is widely expressed in human tissues. Recent studies shows PPAPDC2 is a functional isoprenoid diphosphate phosphatase.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IY26
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 403313
Name Human PPAPDC2 (aa 192-223) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4932443D16Rik; bA6J24.6; FLJ46512; FLJ90191; MGC15483; PDP1; phosphatidic acid phosphatase type 2 domain containing 2; phosphatidic acid phosphatase type 2 domain-containing protein 2; Phospholipid phosphatase 6; PLPP6; polyisoprenoid diphosphate phosphatase type 1; PPAP2 domain-containing protein 2; Ppapdc2; Presqualene diphosphate phosphatase; PSDP; RP11-6J24.2
Common Name PPAPDC2
Gene Symbol PLPP6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.