missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPAP2B (aa 146-195) Control Fragment Recombinant Protein

Product Code. 30202826
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202826

Brand: Invitrogen™ RP101078

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83041 (PA5-83041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Human vascular endothelial growth factor produced in E.Coli is a double, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 38231 Dalton. The rHuVEGF is purified by proprietary chromatographic techniques.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14495
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8613
Name Human PPAP2B (aa 146-195) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003O22Rik; 2610002D05Rik; AV025606; D4Bwg0538e; D4Bwg1535e; differentially expressed in rat intestine 42; Dri42; EC 3.1.3.4; ER transmembrane protein Dri 42; lipid phosphate phosphohydrolase 3; Lpp3; MGC15306; PAP2 beta; PAP2B; PAP-2 b; PAP2-b; PAP2-beta; phosphatidate phosphohydrolase type 2 b; Phosphatidic acid phosphatase 2 b; phosphatidic acid phosphatase type 2 B; phospholipid phosphatase 3; PLPP3; Ppab2b; PPAP2B; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; Vascular endothelial growth factor and type I collagen-inducible protein; VCIP
Common Name PPAP2B
Gene Symbol PLPP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.