missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205374

Invitrogen™ Human POU5F1B (aa 51-101) Control Fragment Recombinant Protein

Product Code. 30205374
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205374

Brand: Invitrogen™ RP105098

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66155 (PA5-66155. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This intronless gene was thought to be a transcribed pseudogene of POU class 5 homeobox 1, however, it has been reported that this gene can encode a functional protein. The encoded protein is nearly the same length as and highly similar to the POU class 5 homeobox 1 transcription factor, has been shown to be a weak transcriptional activator and may play a role in carcinogenesis and eye development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06416
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5462
Name Human POU5F1B (aa 51-101) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias OCT4PG1; Oct4-pg1; octamer binding protein 3 _like sequence; Octamer-binding protein 3-like; Octamer-binding transcription factor 3-like; OTF3C; OTF3P1; POU 5 domain protein; POU class 5 homeobox 1 pseudogene 1; POU class 5 homeobox 1 B; POU domain transcription factor Oct-4; POU domain transcription factor OCT4-pg1; POU domain, class 5, transcription factor 1 pseudogene 1; POU5F1B; POU5F1P1; POU5F1P4; POU5FLC20; POU5FLC8; Putative POU domain, class 5, transcription factor 1 B
Common Name POU5F1B
Gene Symbol POU5F1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.