Invitrogen™ Human POU3F4 (aa 48-97) Control Fragment Recombinant Protein

Product Code. 30203453

Brand: Invitrogen™ RP108469

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POU3F4 (brain-specific homeobox/POU domain protein 4, brain-4, Brn-4, transcription factor 4) is a transcription factor with a POU domain.

Specifications

• Accession Number: P49335
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5456
• Name: Human POU3F4 (aa 48-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: brain-4; brain-4 class III POU-domain protein; brain-specific homeobox/POU domain protein 4; BRN4; Brn-4; DFN3; DFN x 2; OCT-9; Octamer-binding protein 9; octamer-binding transcription factor 9; Otf9; OTF-9; POU class 3 homeobox 4; POU domain, class 3, transcription factor 4; POU3F4; RHS2; RHS2 class III POU protein; sex linked fidget; Slf
• Common Name: POU3F4
• Gene Symbol: POU3F4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining