Invitrogen™ Human POU3F2 (aa 5-54) Control Fragment Recombinant Protein

Product Code. 30206982

Brand: Invitrogen™ RP106142

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.

Specifications

• Accession Number: P20265
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5454
• Name: Human POU3F2 (aa 5-54) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 7-Oct; 9430075J19Rik; A230098E07Rik; Brain-2; brain-2 class III POU-domain protein; brain-specific homeobox/POU domain protein 2; BRN2; Brn-2; Nervous system-specific octamer-binding transcription factor N-Oct-3; N-Oct3; OCT7; Oct-7; Octamer-binding protein 7; octamer-binding transcription factor 7; Otf7; OTF-7; POU class 3 homeobox 2; POU domain, class 3, transcription factor 2; POU3F2; POUF3; protein Brn-2; Unknown (protein for MGC:137739)
• Common Name: POU3F2
• Gene Symbol: POU3F2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining