missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human POT1 (aa 104-188) Control Fragment Recombinant Protein

Product Code. 30201232
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201232

Brand: Invitrogen™ RP105452

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66996 (PA5-66996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POT1 is a component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. It is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Pot1 also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. It binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Its activity is TERT dependent but it does not increase TERT activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NUX5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25913
Name Human POT1 (aa 104-188) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500031H18Rik; AI505244; AI851169; CMM10; DKFZp586D211; Dolichyl-phosphate-mannose--protein mannosyltransferase 1; GLM9; HPOT1; mPot1; Pomt1; POT 1; POT1; POT-1; Pot1a; POT1-like telomere end-binding protein; protection of telomeres 1; protection of telomeres 1 homolog; protection of telomeres 1 A; protection of telomeres protein 1; protein O-mannosyltransferase 1; Protein O-mannosyl-transferase 1; protein-O-mannosyltransferase 1
Common Name POT1
Gene Symbol POT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.