Invitrogen™ Human POMGNT2 (aa 350-439) Control Fragment Recombinant Protein

Product Code. 30212753

Brand: Invitrogen™ RP96352

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57085 (PA5-57085. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

• Accession Number: Q8NAT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84892
• Name: Human POMGNT2 (aa 350-439) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ago61; C22H3orf39; C23H3orf39; C3orf39; C85492; Eogtl; Extracellular O-linked N-acetylglucosamine transferase-like; glycosyltransferase; glycosyltransferase ago61; glycosyltransferase-like domain containing 2; glycosyltransferase-like domain-containing protein 2; GTDC2; MDDGA8; Pomgnt2; protein O-linked mannose beta 1,4-N-acetylglucosaminyltransferase 2; protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-); protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2; RGD1304827
• Common Name: POMGNT2
• Gene Symbol: POMGNT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPENTVTHPERPWDQGGITHLDRAEQARILQSREVPRHLCCRN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining