Invitrogen™ Human POLR3F (aa 221-308) Control Fragment Recombinant Protein

Product Code. 30181836

Brand: Invitrogen™ RP99441

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61971 (PA5-61971. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human POLR3F is a component of RNA III polymerase. RNA polymerase III transcribes many essential, small, noncoding RNAs, including the 5S rRNAs and tRNAs. While most pol III-transcribed genes are found scattered throughout the linear chromosome maps or in multiple linear clusters, there is increasing evidence that many of these genes prefer to be spatially clustered, often at or near the nucleolus. This association could create an environment that fosters the coregulation of transcription by pol III with transcription of the large ribosomal RNA repeats by RNA polymerase I (pol I) within the nucleolus. Given the high number of pol III-transcribed genes in all eukaryotic genomes, the spatial organization of these genes is likely to affect a large portion of the other genes in a genome. POLR3F has also been recently identified as an HIV dependency factor (HDF), suggesting that POLR3F may be an important drug target in HIV treatment. At least two isoforms of POLR3F are known to exist.

Specifications

• Accession Number: Q9H1D9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10621
• Name: Human POLR3F (aa 221-308) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810411G20Rik; 3010019O03Rik; 3110032A07Rik; DNA-directed RNA polymerase III subunit F; DNA-directed RNA polymerase III subunit RPC6; Polr3f; polymerase (RNA) III (DNA directed) polypeptide F; polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa; polymerase (RNA) III subunit F; RNA polymerase III 39 kDa subunit; RNA polymerase III C39 subunit; RNA polymerase III subunit C6; RNA polymerase III subunit F; RPC39; RPC6
• Common Name: POLR3F
• Gene Symbol: POLR3F
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGGEISPSNCI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining