Invitrogen™ Human POLR3E (aa 355-448) Control Fragment Recombinant Protein

Product Code. 30182512

Brand: Invitrogen™ RP98554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59585 (PA5-59585. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Essential for efficient transcription from both the type 2 VAI and type 3 U6 RNA polymerase III promoters. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

Specifications

• Accession Number: Q9NVU0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55718
• Name: Human POLR3E (aa 355-448) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DNA-directed RNA polymerase III 80 kDa polypeptide; DNA-directed RNA polymerase III subunit RPC5; KIAA1452; POLR3E; polymerase (RNA) III (DNA directed) polypeptide E; polymerase (RNA) III (DNA directed) polypeptide E (80 kD); polymerase (RNA) III subunit E; RGD1308086; RNA polymerase III 80 kDa subunit RPC5; RNA polymerase III polypeptide E; RNA polymerase III subunit 5; RNA polymerase III subunit C5; RNA polymerase III subunit E; RPC5; Sex-lethal interactor homolog; Sin; Sxl interactor
• Common Name: POLR3E
• Gene Symbol: POLR3E
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining