Invitrogen™ Human POLR3D (aa 87-150) Control Fragment Recombinant Protein

Product Code. 30194778

Brand: Invitrogen™ RP103682

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-84490 (PA5-84490, PA5-64371 (PA5-64371. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer.

Specifications

• Accession Number: P05423
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 661
• Name: Human POLR3D (aa 87-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810426M17Rik; 44 kDa; AI326118; AW489084; BN51; BN51 (BHK21) temperature sensitivity complementing; Bn51t; DNA-directed RNA polymerase III 47 kDa polypeptide; DNA-directed RNA polymerase III subunit C4; DNA-directed RNA polymerase III subunit D; DNA-directed RNA polymerase III subunit RPC4; HO x 1 C; Polr3d; polymerase (RNA) III (DNA directed) polypeptide D; polymerase (RNA) III (DNA directed) polypeptide D, 44 kDa; polymerase (RNA) III subunit D; Protein BN51; RNA polymerase III 47 kDa subunit; RNA polymerase III subunit C4; RNA polymerase III subunit D; RPC4; RPC53; RPC53 homolog; temperature sensitive complementation, cell cycle specific, tsBN51; TSBN51
• Common Name: POLR3D
• Gene Symbol: Polr3d
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining