Invitrogen™ Human POLR3C (aa 244-327) Control Fragment Recombinant Protein

Product Code. 30198735

Brand: Invitrogen™ RP94513

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55640 (PA5-55640. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3C is a specific core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. POLR3C may direct with other members of the subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. POLR3C may be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. POLR3C plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses.POLR3C acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3C can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

Specifications

• Accession Number: Q9BUI4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10623
• Name: Human POLR3C (aa 244-327) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933407E01Rik; DNA-directed III 62 kDa polypeptide; DNA-directed RNA polymerase III subunit C; DNA-directed RNA polymerase III subunit RPC3; hypothetical protein LOC507314; POLR3C; polymerase (RNA) III (DNA directed) polypeptide C; polymerase (RNA) III (DNA directed) polypeptide C (62 kD); polymerase (RNA) III subunit C; RNA polymerase III 62 kDa subunit; RNA polymerase III subunit C; RNA polymerase III subunit C3; RPC3; RPC62
• Common Name: POLR3C
• Gene Symbol: POLR3C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVGYNISKQVLDQYLTLLADDPLEFVGKSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining