Invitrogen™ Human POLR3B (aa 191-282) Control Fragment Recombinant Protein

Product Code. 30181343

Brand: Invitrogen™ RP97632

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57671 (PA5-57671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POLR3B (RNA Polymerase III Subunit B) is a Protein Coding gene. Diseases associated with POLR3B include Leukodystrophy, Hypomyelinating, 8, With Or Without Oligodontia And/Or Hypogonadotropic Hypogonadism and Cerebellar Hypoplasia With Endosteal Sclerosis. Among its related pathways are RNA Polymerase II Transcription Initiation And Promoter Clearance and ATP/ITP metabolism. Gene Ontology (GO) annotations related to this gene include DNA-directed 5'-3' RNA polymerase activity and ribonucleoside binding. An important paralog of this gene is POLR2B.

Specifications

• Accession Number: Q9NW08
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55703
• Name: Human POLR3B (aa 191-282) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700078H01Rik; A330032P03Rik; C128; C85372; DNA-directed RNA polymerase III 127.6 kDa polypeptide; DNA-directed RNA polymerase III B; DNA-directed RNA polymerase III subunit B; DNA-directed RNA polymerase III subunit RPC2; FLJ10388; HLD8; INMAP; interphase nucleus and mitotic apparatus associated protein; POLR3B; polymerase (RNA) III (DNA directed) polypeptide B; polymerase (RNA) III subunit B; RGD1565311; RNA polymerase III subunit B; RNA polymerase III subunit C2; RNA polymerase III subunit RPC2 homolog; RPC2; si:dkey-103i16.3; slim jim; slj; wu:fc20h06
• Common Name: POLR3B
• Gene Symbol: POLR3B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining