missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211337

Invitrogen™ Human POLR2J Control Fragment Recombinant Protein

Product Code. 30211337
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211337

Brand: Invitrogen™ RP108176

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52435
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5439
Name Human POLR2J Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 14.5 kDa; DNA-directed RNA polymerase II 13.3 kDa polypeptide; DNA-directed RNA polymerase II subunit J; DNA-directed RNA polymerase II subunit J-1; DNA-directed RNA polymerase II subunit RPB11; DNA-directed RNA polymerase II subunit RPB11-a; hRPB14; Polr2i; POLR2J; POLR2J1; polymerase (RNA) II (DNA directed) polypeptide I; polymerase (RNA) II (DNA directed) polypeptide J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3 kDa; polymerase (RNA) II subunit J; RNA polymerase II 13.3 kDa subunit; RNA polymerase II 4 (14 kDa subunit); RNA polymerase II subunit B11; RNA polymerase II subunit B11-a; RNA polymerase II subunit J; RNA polymerase II subunit RPB14; RPB11; RPB11A; RPB11m; RPB14; Rpo2-4
Common Name POLR2J
Gene Symbol POLR2J
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VGWTLARVPRPGTALACFFGGPQGEAAVMEEQGLPPQAPGHVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.