Invitrogen™ Human POLR2J (aa 53-106) Control Fragment Recombinant Protein

Product Code. 30200160

Brand: Invitrogen™ RP104365

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60587 (PA5-60587. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB11 is part of the core element with the central large cleft.

Specifications

• Accession Number: P52435
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5439
• Name: Human POLR2J (aa 53-106) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14.5 kDa; DNA-directed RNA polymerase II 13.3 kDa polypeptide; DNA-directed RNA polymerase II subunit J; DNA-directed RNA polymerase II subunit J-1; DNA-directed RNA polymerase II subunit RPB11; DNA-directed RNA polymerase II subunit RPB11-a; hRPB14; Polr2i; POLR2J; POLR2J1; polymerase (RNA) II (DNA directed) polypeptide I; polymerase (RNA) II (DNA directed) polypeptide J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3 kDa; polymerase (RNA) II subunit J; RNA polymerase II 13.3 kDa subunit; RNA polymerase II 4 (14 kDa subunit); RNA polymerase II subunit B11; RNA polymerase II subunit B11-a; RNA polymerase II subunit J; RNA polymerase II subunit RPB14; RPB11; RPB11A; RPB11m; RPB14; Rpo2-4
• Common Name: POLR2J
• Gene Symbol: POLR2J
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining