missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195024

Invitrogen™ Human POLR2D (aa 76-142) Control Fragment Recombinant Protein

Product Code. 30195024
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195024

Brand: Invitrogen™ RP96124

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65128 (PA5-65128, PA5-61147 (PA5-61147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15514
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5433
Name Human POLR2D (aa 76-142) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310002G05Rik; 2610028L19Rik; DNA-directed RNA polymerase II 16 kDa polypeptide; DNA-directed RNA polymerase II subunit D; DNA-directed RNA polymerase II subunit RPB4; HSRBP4; HSRPB4; plasma; POLR2D; polymerase (RNA) II (DNA directed) polypeptide D; polymerase (RNA) II subunit D; RBP4; RNA polymerase II 16 kDa subunit; RNA polymerase II subunit B4; RNA polymerase II subunit D; RNA polymerase II subunit hsRBP4; RPB16
Common Name POLR2D
Gene Symbol Polr2d
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.