Invitrogen™ Human POLR1E (aa 200-300) Control Fragment Recombinant Protein

Product Code. 30207969

Brand: Invitrogen™ RP106393

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111351 (PA5-111351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors (PubMed:24207024). Appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF (PubMed:24207024). [UniProt]

Specifications

• Accession Number: Q9GZS1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64425
• Name: Human POLR1E (aa 200-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 53 kDa; AU042259; D030019D19Rik; DNA-directed RNA polymerase I subunit E; DNA-directed RNA polymerase I subunit RPA49; FLJ13390; FLJ13970; hypothetical protein LOC511587; Paf53; Polr1e; polymerase (RNA) I associated factor 1; polymerase (RNA) I polypeptide E; polymerase (RNA) I polypeptide E, 53 kDa; polymerase (RNA) I subunit E; PRAF1; RGD1565773; RNA polymerase I associated factor (Paf53); RNA polymerase I associated factor 53; RNA polymerase I subunit A49; RNA polymerase I subunit E; RNA polymerase I-associated factor 1; RNA polymerase I-associated factor 53; RP11-405L18.3
• Common Name: POLR1E
• Gene Symbol: Polr1e
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFLDTLIKFRAHRVVKRKSALGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining