Invitrogen™ Human POLR1C (aa 96-195) Control Fragment Recombinant Protein

Product Code. 30207740

Brand: Invitrogen™ RP94949

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111008 (PA5-111008. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA polymerases transcribe nuclear genes for ribosomal RNA, thus representing ribosomal biogenesis. RNA polymerase I (Pol I) is located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription machinery are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I transcription. RPA16, RPA40 and RPA135 are subunits of Pol I that associate with each other at an early stage of RNA Pol I assembly. RPA40 is essential for the function and integrity of the complex and is also an essential subunit of RNA polymerase III (Pol III).

Specifications

• Accession Number: O15160
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9533
• Name: Human POLR1C (aa 96-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 40 kDa; AA409007; AA959927; Ac2-127; AC40; AL024089; DNA-directed RNA polymerase I subunit C; DNA-directed RNA polymerases I and III 40 kDa polypeptide; DNA-directed RNA polymerases I and III subuni RPAC1-like protein; DNA-directed RNA polymerases I and III subunit RPAC1; HLD11; Polr1c; POLR1E; polymerase (RNA) I polypeptide C; polymerase (RNA) I polypeptide C, 30 kDa; polymerase (RNA) I subunit C; RNA polymerase 1-1; RNA polymerase 1-1 (40 kDa subunit); RNA polymerase I 140 kDa subunit; RNA polymerase I and III subunit C; RNA polymerase I subunit; RNA polymerase I subunit C; RNA polymerase subunit I; RNA polymerases I and III subunit AC1; RPA39; RPA40; RPA5; RPAC1; RPC40; Rpo1-1; TCS3; Unknown (protein for MGC:134521); zgc:65973
• Common Name: POLR1C
• Gene Symbol: POLR1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NNTSIVQDEILAHRLGLIPIHADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining