Invitrogen™ Human POLN (aa 654-743) Control Fragment Recombinant Protein

Product Code. 30196356

Brand: Invitrogen™ RP105910

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65161 (PA5-65161. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a DNA polymerase type-A family member. The encoded protein plays a role in DNA repair and homologous recombination. This gene shares its 5' exons with some transcripts from overlapping GeneID: 79441, which encodes an augmentin-like protein complex subunit. [provided by RefSeq, Dec 2014].

Specifications

• Accession Number: Q7Z5Q5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 353497
• Name: Human POLN (aa 654-743) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DNA polymerase N; DNA polymerase nu; DNA polymerase POL4P; DNA-directed DNA polymerase nu; POL4P; POLN; polymerase (DNA directed) nu; polymerase (DNA) nu
• Common Name: POLN
• Gene Symbol: POLN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FSTLTSQWKDVPVEQVTHADREQTKKVVYAVVYGAGKERLAACLGVPIQEAAQFLESFLQKYKKIKDFARAAIAQCHQTGCVVSIMGRRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining