Invitrogen™ Human POLG (aa 600-683) Control Fragment Recombinant Protein

Product Code. 30205171

Brand: Invitrogen™ RP109674

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P54098
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5428
• Name: Human POLG (aa 600-683) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA409516; DNA polymerase gamma; DNA polymerase gamma subunit 1 (Mitochondrial DNA polymerase catalytic subunit) (PolG-alpha); DNA polymerase gamma, catalytic subunit; DNA polymerase subunit gamma-1; DNA-directed DNA polymerase gamma; FLJ27114; MDP1; Mip1; MIRAS; Mitochondrial DNA polymerase catalytic subunit; mitochondrial DNA polymerase gamma; mitochondrial DNA polymerase gamma catalytic subunit; mitochondrial DNA polymerase-gamma; mitochondrial polymerase gamma; MTDPS4A; MTDPS4B; PEO; Pol gamma; Polg; POLG1; POLGA; PolG-alpha; polymerase (DNA directed), gamma; polymerase (DNA) gamma, catalytic subunit; polymerase, gamma; SANDO; SCAE; truncated mitochondrial DNA polymerase gamma catalytic subunit
• Common Name: POLG
• Gene Symbol: POLG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKLMALTWDGFPLHYSERHGWGYLVPGRRDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining