Invitrogen™ Human POLE4 (aa 60-117) Control Fragment Recombinant Protein

Product Code. 30196498

Brand: Invitrogen™ RP104126

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64473 (PA5-64473. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Specifications

• Accession Number: Q9NR33
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56655
• Name: Human POLE4 (aa 60-117) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2400007P05Rik; 5830430F06Rik; DNA polymerase epsilon 4, accessory subunit; DNA polymerase epsilon p12 subunit; DNA polymerase epsilon subunit 4; DNA polymerase epsilon subunit p12; DNA polymerase II subunit 4; DNA-directed DNA polymerase epsilon 4; p12; Pole4; polymerase (DNA) epsilon 4, accessory subunit; polymerase (DNA-directed), epsilon 4 (p12 subunit); polymerase (DNA-directed), epsilon 4, accessory subunit; YHHQ1
• Common Name: POLE4
• Gene Symbol: POLE4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining