missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human POLE2 (aa 50-185) Control Fragment Recombinant Protein

Product Code. 30195274
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195274

Brand: Invitrogen™ RP89009

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA replication, recombination and repair, all of which are necessary for genome stability, require the presence of exonucleases. In DNA replication, these enzymes are involved in the processing of Okazaki fragments, whereas in DNA repair, they function to excise damaged DNA fragments and correct recombinational mismatches. Exonucleases involved in these processes include DNA polymerases, including DNA pol delta and epsilon. DNA pol delta consists of two subunits-p125 which interacts directly with the sliding DNA clamp protein PCNA, and p50. DNA pol delta can be regulated by cell cycle proteins. DNA pol epsilon is a multiple subunit enzyme, the catalytic subunit of which is encoded by the POL2 gene. The exact reactions catalyzed by DNA pol delta and epsilon on leading and lagging strands have not yet been elucidated.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56282
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5427
Name Human POLE2 (aa 50-185) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DNA pol epsilon2; DNA pol epsilonB; DNA polymerase epsilon 2, accessory subunit; DNA polymerase epsilon small subunit; DNA polymerase epsilon subunit 2; DNA polymerase epsilon subunit B; DNA polymerase epsilon, subunit 2; DNA polymerase II subunit 2; DNApol epsilon2; DNApol epsilonB; DPE2; POLE2; polymerase (DNA directed), epsilon 2 (p59 subunit); polymerase (DNA directed), epsilon 2, accessory subunit; polymerase (DNA) epsilon 2, accessory subunit
Common Name POLE2
Gene Symbol POLE2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.