Invitrogen™ Human POLE2 (aa 50-185) Control Fragment Recombinant Protein

Product Code. 30195274

Brand: Invitrogen™ RP89009

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA replication, recombination and repair, all of which are necessary for genome stability, require the presence of exonucleases. In DNA replication, these enzymes are involved in the processing of Okazaki fragments, whereas in DNA repair, they function to excise damaged DNA fragments and correct recombinational mismatches. Exonucleases involved in these processes include DNA polymerases, including DNA pol delta and epsilon. DNA pol delta consists of two subunits-p125 which interacts directly with the sliding DNA clamp protein PCNA, and p50. DNA pol delta can be regulated by cell cycle proteins. DNA pol epsilon is a multiple subunit enzyme, the catalytic subunit of which is encoded by the POL2 gene. The exact reactions catalyzed by DNA pol delta and epsilon on leading and lagging strands have not yet been elucidated.

Specifications

• Accession Number: P56282
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5427
• Name: Human POLE2 (aa 50-185) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DNA pol epsilon2; DNA pol epsilonB; DNA polymerase epsilon 2, accessory subunit; DNA polymerase epsilon small subunit; DNA polymerase epsilon subunit 2; DNA polymerase epsilon subunit B; DNA polymerase epsilon, subunit 2; DNA polymerase II subunit 2; DNApol epsilon2; DNApol epsilonB; DPE2; POLE2; polymerase (DNA directed), epsilon 2 (p59 subunit); polymerase (DNA directed), epsilon 2, accessory subunit; polymerase (DNA) epsilon 2, accessory subunit
• Common Name: POLE2
• Gene Symbol: POLE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining