Invitrogen™ Human POLD3 (aa 269-344) Control Fragment Recombinant Protein

Product Code. 30210644

Brand: Invitrogen™ RP103343

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63618 (PA5-63618. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA replication, recombination and repair, all of which are necessary for genomic stability, require the presence of exonucleases. In DNA replication, exonucleases are involved in the processing of Okazaki fragments, whereas in DNA repair, they function to excise damaged DNA fragments and correct recombinational mismatches. These exonucleases include the family of DNA polymerases, namely DNA pol alpha, beta, delta and epsilon. DNA pol delta and DNA pol epsilon are multisubunit enzymes, with DNA pol delta consisting of two subunits which interact with the sliding DNA clamp protein PCNA. DNA pol delta 3, also known as POLD3 or p66, is a 466 amino acid nuclear protein that is required for the proper function of DNA pol delta.

Specifications

• Accession Number: Q15054
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10714
• Name: Human POLD3 (aa 269-344) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410142G14Rik; C85233; DNA pol delta3; DNA polymerase delta 3, accessory subunit; DNA polymerase delta subunit 3; DNA polymerase delta subunit C; DNA polymerase delta subunit p66; DNA polymerase delta subunit p68; DNA-directed DNA polymerase delta 3; DNApol delta3; GC12; KIAA0039; P66; P68; Pol delta C subunit (p66); POLD3; polymerase (DNA directed), delta 3; polymerase (DNA) delta 3, accessory subunit; polymerase (DNA-directed), delta 3, accessory subunit; PPP1R128; protein phosphatase 1, regulatory subunit 128
• Common Name: POLD3
• Gene Symbol: POLD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining