Invitrogen™ Human POLD2 (aa 122-233) Control Fragment Recombinant Protein

Product Code. 30207146

Brand: Invitrogen™ RP92687

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55401 (PA5-55401. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of the small subunit is not yet clear.

Specifications

• Accession Number: P49005
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5425
• Name: Human POLD2 (aa 122-233) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 50 kDa; DAN polymerase delta 2, accessory subunit; DNA polymerase delta subunit 2; DNA polymerase delta subunit p50; DNA-directed DNA polymerase delta 2; p50; po1D2; Pol delta B subunit (p50); POLD2; polymerase (DNA directed), delta 2, accessory subunit; polymerase (DNA directed), delta 2, regulatory subunit; polymerase (DNA directed), delta 2, regulatory subunit 50 kDa; polymerase (DNA) delta 2, accessory subunit
• Common Name: POLD2
• Gene Symbol: POLD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining