Invitrogen™ Human POFUT1 (aa 284-379) Control Fragment Recombinant Protein

Product Code. 30181856

Brand: Invitrogen™ RP99323

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62980 (PA5-62980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

POFUT1, an endoplasmic reticulum-residing member of the glycosyltransferase O-Fuc family, adds O-fucose through an O-glycosidic linkage to conserved serine or threonines in epidermal growth factor-like repeats of several cell surface and secreted proteins. Unlike its homolog POFUT2, POFUT1 can also catalyze the transfer of fucose to thrombospondin type 1 repeats. Many of the substrates of POFUT1 are involved in ligand-induced receptor signaling. One such protein is Notch; mouse ES cells lacking POFUT have normal levels of Notch receptors at the cell surface, but these receptors do not bind Notch ligands or exhibit Notch signaling.

Specifications

• Accession Number: Q9H488
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23509
• Name: Human POFUT1 (aa 284-379) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DDD2; FUT12; GDP-fucose protein O-fucosyltransferase 1; KIAA0180; mKIAA0180; o-fucosyltransferase protein; O-Fuc-T; OFUCT1; O-FucT-1; O-FucT-1 A; O-FucT-1 b; O-FUT; peptide-O-fucosyltransferase 1; Pofut1; pofut1 {ECO:0000312; protein O-fucosyltransferase 1; protein O-fucosyltransferase 1 isoform 1 precursor; protein O-fucosyltransferase 1 A; protein O-fucosyltransferase 1 b; protein-O-fucosyltransferase 1; RGD:1303001}; zgc:110472
• Common Name: POFUT1
• Gene Symbol: POFUT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining