Invitrogen™ Human PNRC1 (aa 198-295) Control Fragment Recombinant Protein

Product Code. 30205270

Brand: Invitrogen™ RP94888

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56272 (PA5-56272. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear receptor coactivator. May play a role in signal transduction. Classified as a a proline rich protein found enriched in bronchiolar epithelial cells.

Specifications

• Accession Number: Q12796
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10957
• Name: Human PNRC1 (aa 198-295) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B4-2; PNAS-145; PNRC1; PROL2; proline rich 2 protein; proline rich nuclear receptor coactivator 1; proline-rich nuclear receptor coactivator 1; proline-rich polypeptide 2; proline-rich protein 2; proline-rich protein with nuclear targeting signal; protein B4-2; PRR2
• Common Name: PNRC1
• Gene Symbol: PNRC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining