Invitrogen™ Human PNP Control Fragment Recombinant Protein

Product Code. 30181222

Brand: Invitrogen™ RP98841

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51616 (PA5-51616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the DEAH box polypeptide family. The encoded protein contains the DEAH (Asp-Glu-Ala-His) motif which is characteristic of all DEAH box proteins, and is thought to function as an ATP-dependent RNA helicase that regulates the release of spliced mRNAs from spliceosomes prior to their export from the nucleus. This protein may be required for the replication of human immunodeficiency virus type 1 (HIV-1). Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P00491
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4860
• Name: Human PNP Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL024301; AU015798; endothelial dysfunction inducing protein; epididymis secretory sperm binding protein Li 156 an; HEL-S-156 an; inosine phosphorylase; inosine phosphorylase {ECO:0000250; Inosine-guanosine phosphorylase; Np; Np-1; Np-2; nucleoside phosphorylase; PNP; PNP {ECO:0000250; Pnp1; PRO1837; PUNP; purine nucleoside phosphorylase; purine nucleoside phosphorylase {ECO:0000250; purine-nucleoside phosphorylase; purine-nucleoside phosphorylase 1; purine-nucleoside:orthophosphate ribosyltransferase; UniProtKB:P00491}
• Common Name: PNP
• Gene Symbol: PNP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining