Invitrogen™ Human PNMA5 (aa 370-444) Control Fragment Recombinant Protein

Product Code. 30200645

Brand: Invitrogen™ RP100471

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60796 (PA5-60796. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the paraneoplastic Ma antigen protein family. These proteins have been implicated in the development of paraneoplastic disorders resulting from an immune response directed against them. Paraneoplastic disorders are the result of an abnormal immune response to a tumor. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Oct 2011].

Specifications

• Accession Number: Q96PV4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114824
• Name: Human PNMA5 (aa 370-444) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA1934; Paraneoplastic antigen-like protein 5; paraneoplastic Ma antigen family member 5; PNMA5; Tumor antigen BJ-HCC-25
• Common Name: PNMA5
• Gene Symbol: PNMA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QARSFSDSSPQTIQGGLPPLVKRRRLLGSESTRGEDHGQATYPKAENQTPGREGPQAAGEELGNEAGAGAMSHPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining