Invitrogen™ Human PNAS4 (aa 7-96) Control Fragment Recombinant Protein

Product Code. 30181639

Brand: Invitrogen™ RP99772

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65589 (PA5-65589. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PNAS4 is a highly conserved protein that shares high homology from plants to animals. It was initially identified as a putative apoptosis-related protein in the human acute promyelocytic leukemia cell line NB4. PNAS4 is activated during the early response to DNA damage and can inhibit proliferation via apoptosis when overexpressed in some tumor cells such as U2OS, SKOV3, and A549. PNAS4 inhibits tumor cell proliferation through the following mechanisms: (i) overexpression of PNAS4 causes S phase arrest by regulating the expression of cell cycle-related proteins and (ii) PNAS4 induces apoptosis through the mitochondrial apoptosis pathway. Recent evidence has shown that PNAS4 may be involved in the genesis of some cancers and could be a potential candidate for lung cancer therapy alone or in combination with gemcitabine. At least two isoforms of PNAS4 are known to exist.

Specifications

• Accession Number: Q9BSY9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51029
• Name: Human PNAS4 (aa 7-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830417C01Rik; C1orf121; cb238; CGI-146; DESI; DESI1; desi2; DeSI-2; desumoylating isopeptidase 1; desumoylating isopeptidase 2; Deubiquitinase DESI2; Fam152a; family with sequence similarity 152, member A; fi12d12; hypothetical protein LOC445138; pnas4; PNAS-4; PPPDE peptidase domain containing 1; PPPDE peptidase domain-containing protein 1; Pppde1; Protein FAM152A; sb:cb238; si:ch211-132e22.3; wu:fi12d12; zgc:100860
• Common Name: PNAS4
• Gene Symbol: DESI2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining