Invitrogen™ Human PMFBP1 (aa 180-316) Control Fragment Recombinant Protein

Product Code. 30196980

Brand: Invitrogen™ RP106723

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66035 (PA5-66035, PA5-139997 (PA5-139997. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play a role in sperm morphology especially the sperm tail and consequently affect fertility. May also be involved in the general organization of cellular cytoskeleton.

Specifications

• Accession Number: Q8TBY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83449
• Name: Human PMFBP1 (aa 180-316) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700016D22Rik; F77; LOW QUALITY PROTEIN: polyamine-modulated factor 1-binding protein 1; ODF3; outer dense fiber ODF3; outer dense fiber protein 3; PMF-1 binding protein; PMF-1-binding protein; PMFBP1; polyamine modulated factor 1 binding protein 1; polyamine-modulated factor 1-binding protein 1; sperm tail associated protein; sperm tail-associated protein; Stap
• Common Name: PMFBP1
• Gene Symbol: PMFBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYRDKYQSSLSNIELLECQVKMLQGELGGIMGQEPENKGDHSKVRIYTSPCMIQEHQETQKRLSEVWQKVSQQDDLIQELRNKLACSNALVLEREKALIKLQADFASCTATHRYPPSSSEECEDIKKILKHLQEQKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining