Invitrogen™ Human PMCH (aa 29-90) Control Fragment Recombinant Protein

Product Code. 30195319

Brand: Invitrogen™ RP95718

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83802 (PA5-83802. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation.

Specifications

• Accession Number: P20382
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5367
• Name: Human PMCH (aa 29-90) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230109K23Rik; MCH; melanin-concentrating hormone; melanin-concentrating hormone precursor; NEI; Neuropeptide-glutamic acid-isoleucine; neuropeptide-glutamic acid-isoleucine (NEI); Neuropeptide-glycine-glutamic acid; neuropeptide-glycine-glutamic acid (NGE); NGE; Pmch; ppMCH; prepro-MCH; prepro-melanin-concentrating hormone; pro-MCH; pro-melanin concentrating hormone; pro-melanin-concentrating hormone
• Common Name: PMCH
• Gene Symbol: PMCH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining