Invitrogen™ Human PLXNB3 (aa 1031-1137) Control Fragment Recombinant Protein

Product Code. 30198445

Brand: Invitrogen™ RP103015

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61638 (PA5-61638. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q9ULL4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5365
• Name: Human PLXNB3 (aa 1031-1137) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI451018; Ensembl:ENSRNOP00000053235}; FLJ76953; KIAA1206; PLEXB3; plexin 6; plexin B3; plexin-6; Plexin-B3; plexin-B3 {ECO:0000303; PLEXR; Plxn6; PLXNB3; plxnb3 {ECO:0000312; Protein Plxnb3; PubMed:20696765}; RGD1560615
• Common Name: PLXNB3
• Gene Symbol: Plxnb3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining